Dichelobacter nodosus: DNO_1210 Help Entry DNO_1210          CDS       T00517                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dno  Dichelobacter nodosus Pathway dno01100   Metabolic pathways dno01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dno00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DNO_1210 (acpP)    00074 Mycolic acid biosynthesis     DNO_1210 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DNO_1210 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  ABQ14062 UniProt:  A5EXE0 LinkDB All DBs Position 1255845..1256075 Genome browser AA seq 76 aa AA seqDB search MSNIEERVIKVIAEQLNVDEGQVKADAHFIDDLGADSLDLVELVMTLEKEFDCEIPDEEA EKITTVQSAIDFVKSR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtaatattgaagaacgtgtgatcaaagtgattgcggaacaattaaacgttgatgaa ggacaagtgaaagctgatgcccattttatcgatgatttaggcgcagactcattggatttg gtggaattggtgatgactttagaaaaagaatttgactgcgaaattcctgatgaagaagca gaaaaaatcacaaccgtccaatctgcaattgattttgtaaaatcacgctaa

DBGET integrated database retrieval system