Dichelobacter nodosus: DNO_1300 Help Entry DNO_1300          CDS       T00517                                  Name (GenBank) conserved hypothetical protein   KO K03746   DNA-binding protein H-NS Organism dno  Dichelobacter nodosus Brite KEGG Orthology (KO) [BR:dno00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dno03036]     DNO_1300    03400 DNA repair and recombination proteins [BR:dno03400]     DNO_1300 Chromosome and associated proteins [BR:dno03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DNO_1300 DNA repair and recombination proteins [BR:dno03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DNO_1300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS PEHE MgtE_N Motif Other DBs NCBI-ProteinID:  ABQ13559 UniProt:  A5EX59 LinkDB All DBs Position complement(1326938..1327243) Genome browser AA seq 101 aa AA seqDB search MEKLFDYIDALSNDDFETLINYIDKERKKRAREIIAEAQRQASRFAQDIAPTVSRKTASK RPPKFANPDNPEQTWSGMGRQPDWYKAYIDKGGNEKNMLIK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggagaaattatttgattatattgatgcgctatctaatgatgattttgaaacgctcatc aattatattgataaagagcgaaagaaaagagcgcgagaaattatcgccgaagcgcaacgc caagccagccgttttgcgcaggatattgcgccaacggtgagccggaaaacagcgagcaaa cgtccgcctaaatttgctaaccctgataatccggaacaaacttggagcggaatgggacga cagccagattggtataaagcgtatattgataaaggcggcaatgaaaaaaatatgctaatt aaataa

DBGET integrated database retrieval system