Dichelobacter nodosus: DNO_1340 Help Entry DNO_1340          CDS       T00517                                  Symbol groES Name (GenBank) co-chaperonin GroES   KO K04078   chaperonin GroES Organism dno  Dichelobacter nodosus Brite KEGG Orthology (KO) [BR:dno00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dno03110]     DNO_1340 (groES)    03029 Mitochondrial biogenesis [BR:dno03029]     DNO_1340 (groES) Chaperones and folding catalysts [BR:dno03110]  Heat shock proteins   HSP10    DNO_1340 (groES) Mitochondrial biogenesis [BR:dno03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     DNO_1340 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  ABQ13564 UniProt:  A5EX18 LinkDB All DBs Position complement(1370809..1371096) Genome browser AA seq 95 aa AA seqDB search MNLRPLHDRVIVKRQEEEKVSAGGIVLPGSAAEKPSQGEVIAVGEGKLLENGERRKMAVK AGDKILFGKYTGSEVKVDGVDYIIMREDEIFAVIE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaatctgcgtcctttacacgatcgtgtgatcgtaaaacgtcaagaagaagaaaaagta tccgccggcggcatcgttttaccaggttctgcggctgaaaaaccttctcaaggagaagtt attgccgtgggtgaaggcaaattattagaaaatggcgaacgccgcaaaatggctgtaaaa gccggtgacaaaattttattcggtaaatataccggcagcgaagttaaagtagatggtgtt gattacatcatcatgcgcgaagatgaaatttttgccgttattgaataa

DBGET integrated database retrieval system