Devosia neptuniae: N8A98_22050 Help Entry N8A98_22050       CDS       T08915                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dnp  Devosia neptuniae Pathway dnp01100   Metabolic pathways dnp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dnp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N8A98_22050    00074 Mycolic acid biosynthesis     N8A98_22050   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N8A98_22050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  UXN69857 UniProt:  A0ABY6CCL1 LinkDB All DBs Position complement(3924615..3924851) Genome browser AA seq 78 aa AA seqDB search MSDVADRVRKIVVEHLNVDAEKVVEKASFIDDLGADSLDQVELVMAFEEEFSVEIPDDAA ESIQTFGDAVSFLTKAVG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgctgatcgggtccgcaagatcgttgtggaacacctcaatgtggatgcc gagaaagtggtcgaaaaggccagcttcatcgacgatctgggcgccgattcgctcgatcag gtcgagctggtgatggctttcgaagaagaattctcggtcgagattccggatgatgccgcc gagtcgatccagactttcggtgatgctgtttccttcctcaccaaggccgtcggctaa

DBGET integrated database retrieval system