Drosophila navojoa: 108649813 Help Entry 108649813         CDS       T05898                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism dnv  Drosophila navojoa Pathway dnv03030   DNA replication dnv03082   ATP-dependent chromatin remodeling dnv03410   Base excision repair dnv03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dnv00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     108649813    03410 Base excision repair     108649813    03420 Nucleotide excision repair     108649813   09126 Chromosome    03082 ATP-dependent chromatin remodeling     108649813  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dnv03032]     108649813    03036 Chromosome and associated proteins [BR:dnv03036]     108649813    03400 DNA repair and recombination proteins [BR:dnv03400]     108649813 Enzymes [BR:dnv01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      108649813 DNA replication proteins [BR:dnv03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     108649813 Chromosome and associated proteins [BR:dnv03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     108649813 DNA repair and recombination proteins [BR:dnv03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       108649813 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone Pim CENP-T_C MobB Motif Other DBs NCBI-GeneID:  108649813 NCBI-ProteinID:  XP_017954370 UniProt:  A0A484BAQ9 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MVERIEDLNLPNAVIARLIKEALPDGSNVSKEARAAIAKAASVFAIFITSSSTALAHKQN HRTITAKDILQTLNELDFESFVPSLTQDLEVYRKMVKDKKESKANNKKDASTGDAIASSS SAVVVADSEEAA NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggtcgagcgcattgaagacttaaatctgcccaacgctgtgattgcgcgattgattaag gaagccctgcccgatggctccaatgtgagcaaagaggcgcgtgccgcaatcgcaaaagcc gcttcggtttttgcaatatttataacatcgtcctcaactgcactggcgcacaaacagaat cacaggaccattacagctaaggatatcttgcaaacgctaaacgaattggactttgagagc tttgtcccatcgctcacccaagatctggaagtctaccgaaagatggttaaggacaaaaag gagagtaaagccaacaacaagaaagacgcttcaactggagatgccatagcaagtagcagc tcagcggtagtagttgcagatagtgaagaagctgcctaa

DBGET integrated database retrieval system