Drosophila navojoa: 108656065 Help Entry 108656065         CDS       T05898                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism dnv  Drosophila navojoa Pathway dnv04137   Mitophagy - animal dnv04140   Autophagy - animal dnv04144   Endocytosis dnv04145   Phagosome dnv04148   Efferocytosis Brite KEGG Orthology (KO) [BR:dnv00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108656065    04145 Phagosome     108656065    04140 Autophagy - animal     108656065    04137 Mitophagy - animal     108656065    04148 Efferocytosis     108656065  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dnv04131]     108656065   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dnv04147]     108656065    04031 GTP-binding proteins [BR:dnv04031]     108656065 Membrane trafficking [BR:dnv04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108656065 Exosome [BR:dnv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108656065   Exosomal proteins of other body fluids (saliva and urine)    108656065   Exosomal proteins of colorectal cancer cells    108656065   Exosomal proteins of bladder cancer cells    108656065 GTP-binding proteins [BR:dnv04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108656065 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Glyco_hydro_75 Motif Other DBs NCBI-GeneID:  108656065 NCBI-ProteinID:  XP_030239544 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MERFHSIPANMYRDSHCCVLVYDVTSPDSFTDLEMWHTEFLKNINPIDTTRFPFVVIGNK ADLNKYNVSADEVRQWCKLNNNIPHFEISAKDGRHVEDAFRIASKLAMDYAKEMGQTEAD LPTTLEIDEPSQKKKCCCI NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggaacggtttcattcaatccccgcaaacatgtatcgcgactcgcattgctgcgtgctc gtctacgatgtgacttctccagattcatttacagatttagaaatgtggcatactgaattc ctaaaaaatatcaacccaatagacactacgcgttttccctttgtcgtgattggaaataaa gctgatcttaataaatataatgtatcggctgacgaagtcaggcaatggtgtaagctgaac aacaatatacctcatttcgagatctcagcaaaggacggccgacacgtggaagacgctttc aggatagcttcaaaattggctatggactatgcgaaggaaatggggcaaaccgaagcagat ttgcctacaactctagaaattgatgaaccaagtcaaaaaaaaaaatgctgttgcatttaa

DBGET integrated database retrieval system