Drosophila navojoa: 108659100 Help Entry 108659100         CDS       T05898                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism dnv  Drosophila navojoa Pathway dnv04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dnv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     108659100  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dnv04121]     108659100    03400 DNA repair and recombination proteins [BR:dnv03400]     108659100 Ubiquitin system [BR:dnv04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      108659100    Cul5 complex      108659100 DNA repair and recombination proteins [BR:dnv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      108659100 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin GABP-alpha Rad60-SLD Motif Other DBs NCBI-GeneID:  108659100 NCBI-ProteinID:  XP_017967337 UniProt:  A0A484BQH2 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKENTSVIELKRMIEGILKVLPSDQRLYNQDNDVMEDDQTLQD YGVTVSTAKAQAPAQLGLTCRNEAGDFESLEITPYSAPPDLPEVMKNQEASNGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatcagaaggcataagacaaccatctttacggatgctaaggaa aacacatcagttattgagctgaaacgcatgatcgaaggcattttgaaagtgttacccagc gatcagcggttatacaatcaggacaacgatgtcatggaggatgatcaaacgttgcaggac tatggcgttacggtatcaacggcaaaggctcaagccccagcgcagttaggcctaacatgc aggaacgaggcgggcgatttcgagtcgctggaaatcacgccctactcagccccgcctgac ttaccagaagtgatgaaaaatcaagaggcctcaaatggacaggagcaagtggcataa

DBGET integrated database retrieval system