Diuraphis noxia (Russian wheat aphid): 107166351 Help Entry 107166351         CDS       T04900                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism dnx  Diuraphis noxia (Russian wheat aphid) Brite KEGG Orthology (KO) [BR:dnx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dnx03036]     107166351   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dnx04147]     107166351 Chromosome and associated proteins [BR:dnx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107166351 Exosome [BR:dnx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107166351 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  107166351 NCBI-ProteinID:  XP_015370462 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDI QLARRIRGERA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt ttgccgttccaacgtttggtgcgtgaaatcgcacaggatttcaagaccgacctgcgtttc cagagttccgccgtcatggctttgcaagaggccagcgaagcttacttggtcggtctgttc gaggacaccaatctgtgcgccattcacgccaaacgtgtcacgatcatgcctaaagacatc cagttggctcgtcgtatccgtggtgaacgtgcttaa

DBGET integrated database retrieval system