Diuraphis noxia (Russian wheat aphid): 107167897 Help Entry 107167897         CDS       T04900                                  Name (RefSeq) histone H3, embryonic-like   KO K11253   histone H3 Organism dnx  Diuraphis noxia (Russian wheat aphid) Brite KEGG Orthology (KO) [BR:dnx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dnx03036]     107167897   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dnx04147]     107167897 Chromosome and associated proteins [BR:dnx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107167897 Exosome [BR:dnx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107167897 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  107167897 NCBI-ProteinID:  XP_015372595 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLFYGLLRPPAIAAQRCPPHTSGGYPRVEV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcacgaaccaaacaaaccgcccgcaagtccaccggaggtaaagcaccgaggaagcag ctggccaccaaagccgcacgtaagagcgcacccgccaccggtggagttaagaagccacat cgctaccgtccgggaaccgtcgctctacgcgaaatccgtcggtaccagaagagtactgaa ctgttgatccgcaaattaccgttccaacgtttattctatggtttgttacgaccacctgcc attgccgcacagagatgtccgcctcacaccagtggcggctatcctagagtagaagtgtaa

DBGET integrated database retrieval system