Diuraphis noxia (Russian wheat aphid): 107167898 Help Entry 107167898         CDS       T04900                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism dnx  Diuraphis noxia (Russian wheat aphid) Brite KEGG Orthology (KO) [BR:dnx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dnx03036]     107167898 Chromosome and associated proteins [BR:dnx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107167898 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP TFIID_20kDa Motif Other DBs NCBI-GeneID:  107167898 NCBI-ProteinID:  XP_015372596 LinkDB All DBs Position Unknown AA seq 63 aa AA seqDB search RGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG FGG NT seq 192 nt NT seq  +upstreamnt  +downstreamnt cgtggaggagtgaaacgtatttccggtttgatttacgaagaaactcgcggtgtgttgaag gtgttcctggaaaacgtaatccgcgacgccgtcacgtacactgagcacgccaagaggaag accgtcaccgccatggacgttgtctacgctctgaaacgtcaaggccgcactctttacggt ttcggaggttaa

DBGET integrated database retrieval system