Diuraphis noxia (Russian wheat aphid): 107168533 Help Entry 107168533         CDS       T04900                                  Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism dnx  Diuraphis noxia (Russian wheat aphid) Brite KEGG Orthology (KO) [BR:dnx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dnx03036]     107168533 Chromosome and associated proteins [BR:dnx03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      107168533     MLL-HCF complex      107168533     MLL3/MLL4 complex      107168533 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 Motif Other DBs NCBI-GeneID:  107168533 NCBI-ProteinID:  XP_015373458 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MSTSETTNGQVATTPVAPTVDAPPESSVSESQKVTSSENNAKRLKNPKHNAPMRQYLDQT VVPALLVGMKELVKER NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtcaacgtctgaaacgactaacgggcaagtggctactactccagtggcaccgactgtt gatgccccaccagaatcaagtgtttcagaatctcagaargtaacttcctccgagaacaac gctaaaaggctgaaaaatcccaagcataatgcacccatgcgccaatatttagaccaaact gtagtaccagcgttgttagtaggcatgaaggagttagtcaaggaaaggtaa

DBGET integrated database retrieval system