Diuraphis noxia (Russian wheat aphid): 107170564 Help Entry 107170564         CDS       T04900                                  Name (RefSeq) cystathionine gamma-lyase-like   KO K01758   cystathionine gamma-lyase [EC:4.4.1.1] Organism dnx  Diuraphis noxia (Russian wheat aphid) Pathway dnx00260   Glycine, serine and threonine metabolism dnx00270   Cysteine and methionine metabolism dnx00450   Selenocompound metabolism dnx00670   One carbon pool by folate dnx01100   Metabolic pathways dnx01230   Biosynthesis of amino acids Module dnx_M00338   Cysteine biosynthesis, homocysteine + serine => cysteine Brite KEGG Orthology (KO) [BR:dnx00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     107170564    00270 Cysteine and methionine metabolism     107170564   09106 Metabolism of other amino acids    00450 Selenocompound metabolism     107170564   09108 Metabolism of cofactors and vitamins    00670 One carbon pool by folate     107170564  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dnx04147]     107170564 Enzymes [BR:dnx01000]  4. Lyases   4.4  Carbon-sulfur lyases    4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)     4.4.1.1  cystathionine gamma-lyase      107170564 Exosome [BR:dnx04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    107170564 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cys_Met_Meta_PP Motif Other DBs NCBI-GeneID:  107170564 NCBI-ProteinID:  XP_015376201 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search LPLPFSTACGIMSSPFDCYLVNRGLKTLHVRMXEHMKNGLAVAKFLEQHPLVEKVLHPGL PSHPQHKVALKQASGFSGMLSFYIRGGIGEATRFLQAIKVFCLAESLGGFESLADHPALM THASVPEDERAALNITDNLIRLSVGLESEEDLIADLDQALKASVKK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt ttgcctctgccattttcaacagcgtgcggtatcatgtcgtcgcctttcgactgttacctg gtcaaccgcggtctgaaaaccctgcacgtccgcatgaakgagcacatgaagaacggatta gccgtggccaagttcctggaacagcatccgctcgtcgaaaaagtgcttcatccgggtttg ccgtcgcatccccaacacaaggtggctttaaaacaggccagtggtttcagcggaatgttg tcgttttacatcagaggcggtatcggggaagccactagatttttacaagccatcaaagtg ttttgcttagctgaaagtctcggcggcttcgagagtctggccgatcatccagcacttatg actcatgcttcagttcctgaagacgaacgagcagcattaaatattacggacaatttaatc cgtttgtccgtgggattagaatccgaagaagatttaattgctgatctcgatcaagcactt aaagcttctgttaaaaaataa

DBGET integrated database retrieval system