Diuraphis noxia (Russian wheat aphid): 107173818 Help Entry 107173818         CDS       T04900                                  Name (RefSeq) ras-related protein Rab-9A-like   KO K07899   Ras-related protein Rab-9A Organism dnx  Diuraphis noxia (Russian wheat aphid) Brite KEGG Orthology (KO) [BR:dnx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dnx04131]     107173818   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dnx04031]     107173818 Membrane trafficking [BR:dnx04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab GTPases     107173818 GTP-binding proteins [BR:dnx04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     107173818 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA FeoB_N ATPase_2 RsgA_GTPase Septin TniB Motif Other DBs NCBI-GeneID:  107173818 NCBI-ProteinID:  XP_015380002 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MKDKTILVKQNPILKVVILGNSNVGKSCLMNRFVSNSFSDHTLHTLGVEFLQKELDVNGI VYTLQIWDTAGQERFRTLRTPFYRGTDICLLTFAVDDIQSFKTIDSWRKE NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgaaagataaaacgattttagttaaacaaaacccaatattgaaagtagtcattttggga aatagtaatgttggaaaatcatgtctgatgaacaggtttgtaagtaacagttttagtgac catacacttcatacattgggcgtagaatttctccaaaaggaacttgatgtcaatggaatt gtatatactttgcagatttgggatactgcgggacaagaaagatttcgaactcttcgaaca cctttttatagaggaactgacatttgtttgctaacatttgctgttgacgatatccaaagc tttaaaactatagattcatggagaaaagaa

DBGET integrated database retrieval system