Desulfomicrobium orale: AXF15_00285
Help
Entry
AXF15_00285 CDS
T04289
Name
(GenBank) hypothetical protein
Organism
doa
Desulfomicrobium orale
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Hydrolase_3
S6PP
Trehalose_PPase
Motif
Other DBs
NCBI-ProteinID:
AMD91706
UniProt:
A0A0X8JMZ2
LinkDB
All DBs
Position
51981..52820
Genome browser
AA seq
279 aa
AA seq
DB search
MNPPSFRAIFVSDLDGTLLRDDKTASRKDTQALCELQKHGVLRAVATGRSIHSARKCLPP
DFPVDYLIVSTGNQIIRWPDGEALQSARLTSPEIEKTRELLTGLGVNFMIHDDFPDTHHF
SYHRGPAPSADFERRLNLHAAYAREYAGLPGSASQFLAVLDPARDDLFHAIAKASPELSV
VRATSPLDNSSIWVEIFARGVSKASAIDALLHRHGLNGVLTGAIGNDHNDREMLERVHLP
YVVAGAFLPHEPRYIKTPGNNSGAVSFAVSHFLKALNHA
NT seq
840 nt
NT seq
+upstream
nt +downstream
nt
atgaatccaccaagcttccgcgccatctttgtcagcgatctggacggcaccctgctgcga
gacgacaaaacggcttcacgcaaggatacccaggccctgtgcgagctgcaaaaacacggc
gtgctgcgggctgtggccacaggcagatccatccattccgcccgaaaatgcctgccgccg
gactttcctgtggactatctcattgtctccaccggcaaccagatcatccgctggccggat
ggcgaagctcttcagagcgcgcggctgaccagcccggagatcgaaaaaacccgcgagctg
ctgaccggcctgggcgtgaacttcatgattcacgacgattttccggacacacaccacttt
tcctaccatcgcggcccggcacccagtgcggatttcgaacgccgcctgaatctgcatgcc
gcttacgcccgcgaatacgccggacttcccggaagcgcctcccagtttctggctgttctc
gatcccgcccgggacgatctttttcatgccattgccaaggccagtccggaactgagcgtg
gtccgggccacttcaccgctggacaacagctccatctgggtggaaatcttcgcccggggc
gtgtccaaggcctcggccatcgacgccctgctgcaccgccacggcctgaacggcgtcctg
accggagccatcggcaacgaccataacgaccgggaaatgctggaacgggttcatctgccc
tacgtggtcgcaggggcctttctgccccatgaaccccggtacataaaaactcccggcaac
aacagcggcgcggtgtctttcgccgtgtcccactttctcaaagctctgaaccacgcatga
DBGET
integrated database retrieval system