Desulfomicrobium orale: AXF15_06510 Help Entry AXF15_06510       CDS       T04289                                  Name (GenBank) phosphocarrier protein HPr   KO K02784   phosphocarrier protein HPr Organism doa  Desulfomicrobium orale Pathway doa02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:doa00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     AXF15_06510  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:doa02000]     AXF15_06510 Transporters [BR:doa02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     AXF15_06510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr Motif Other DBs NCBI-ProteinID:  AMD92789 UniProt:  A0A0X8JPW7 LinkDB All DBs Position 1430875..1431153 Genome browser AA seq 92 aa AA seqDB search MEEIQEKIIRVGNTLGIHARPAGKISQEAQRYESAVSIHSKDGEADAKSILDILALAAPQ GAELTLRAQGPDAKEAVRALSDLFADMFGEKN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggaagaaatacaggaaaagatcatccgggtcggcaacactctgggcatccatgcccgg cccgcaggaaagatatctcaggaggcccagcgctacgagtccgccgtgagcattcattcc aaagatggggaggctgatgccaaatccattctggatatcctggccctggccgcgccgcag ggcgcggagctgaccctgcgggctcaggggccggatgcgaaagaggcggtacgggctctg agcgatctgtttgcggacatgttcggtgagaagaactga

DBGET integrated database retrieval system