Desulfomicrobium orale: AXF15_07110 Help Entry AXF15_07110       CDS       T04289                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism doa  Desulfomicrobium orale Pathway doa01100   Metabolic pathways doa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:doa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AXF15_07110    00074 Mycolic acid biosynthesis     AXF15_07110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AXF15_07110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AMD92893 UniProt:  A0A0X8JQX4 LinkDB All DBs Position 1546254..1546508 Genome browser AA seq 84 aa AA seqDB search MTNIKEELKQALIEGLNLEDVRPEDIDDDAPLFGEGLGLDSLDAVEIVVLVQRAYGVEIK DMEEGREAFQSINALSAFISRRRG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacgaacatcaaggaagagctcaagcaggccctgatcgaagggctgaatcttgaggat gtgcggcccgaagacatcgacgacgacgctcccctgttcggggaagggctggggctggat tctctggacgccgtggaaatcgtggttctggtgcagcgcgcttacggggtggagataaag gacatggaggagggccgcgaggcctttcagtccatcaacgccctgtccgccttcatcagt cggcgaagaggctga

DBGET integrated database retrieval system