Dolichospermum sp. DL01: HEQ26_22895 Help Entry HEQ26_22895       CDS       T10442                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism doc  Dolichospermum sp. DL01 Pathway doc01100   Metabolic pathways doc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:doc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HEQ26_22895 (acpP)    00074 Mycolic acid biosynthesis     HEQ26_22895 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HEQ26_22895 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QSV65165 LinkDB All DBs Position complement(4823658..4823912) Genome browser AA seq 84 aa AA seqDB search MSQAATFEKVKKIIVEQLSIEDADTVTPQASFVNDLGADSLDTVELVMALEEEFDIEIPD EAAEKILTVQDTVDYISSHATASA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaagcagcaacttttgaaaaagttaaaaaaattatcgttgagcaacttagcata gaggatgcggatacggttacaccacaagccagttttgttaatgatttgggtgctgattcc ctagatacagtggagttagttatggctttggaagaagaatttgatatcgaaattcctgat gaagcggctgaaaaaattctcactgttcaagacactgtggattatatctctagtcacgct actgcatctgcatag

DBGET integrated database retrieval system