Dokdonia sp. Dokd-P16: DCS32_03525 Help Entry DCS32_03525       CDS       T05432                                  Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism dod  Dokdonia sp. Dokd-P16 Brite KEGG Orthology (KO) [BR:dod00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dod03110]     DCS32_03525    03029 Mitochondrial biogenesis [BR:dod03029]     DCS32_03525 Chaperones and folding catalysts [BR:dod03110]  Heat shock proteins   HSP10    DCS32_03525 Mitochondrial biogenesis [BR:dod03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     DCS32_03525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AWH73265 LinkDB All DBs Position 772805..773080 Genome browser AA seq 91 aa AA seqDB search MAIKIKPLADRVVIEPVAAETQTASGLYIPDSAQEKQQKGKVVAVGSGTKDHEMTVAVGD TVIYGKYSGSELKFDGVDYMIMKEDDILAIV NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcaattaaaatcaaaccattagcagaccgcgttgtaatcgagcctgttgcggcagaa actcaaacagcatctggtttatatatcccagatagcgcacaagaaaaacaacaaaaaggt aaagtagtagctgtaggatctggaactaaagatcacgagatgaccgtagctgtaggtgat acagttatatatggaaaatactcaggtagcgaactcaaatttgacggagtagattatatg atcatgaaagaggatgatatccttgcgattgtataa

DBGET integrated database retrieval system