KEGG   Denitratisoma oestradiolicum: DENOEST_3121
Entry
DENOEST_3121      CDS       T06737                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
doe  Denitratisoma oestradiolicum
Pathway
doe03010  Ribosome
Brite
KEGG Orthology (KO) [BR:doe00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DENOEST_3121 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:doe03011]
    DENOEST_3121 (rplR)
Ribosome [BR:doe03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DENOEST_3121 (rplR)
  Bacteria
    DENOEST_3121 (rplR)
  Archaea
    DENOEST_3121 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p Ribosomal_L5e
Other DBs
NCBI-ProteinID: CAB1370275
UniProt: A0A6S6Y191
LinkDB
Position
I:complement(3251528..3251881)
AA seq 117 aa
MDKKQARLRRARKTRAKIAELKSVRLAVHRSNCHIYAQVFSDCGTKVLVAASTAEGNVRA
QVANGGNVEAAKLVGKLIAERALAAGIDQVAFDRSGFHYHGRVKALAEAAREGGLKF
NT seq 354 nt   +upstreamnt  +downstreamnt
atggataagaaacaagctcggttgcgtagggcgcgcaaaacccgcgccaagattgcagag
ctcaagtcggtgcggcttgctgtgcatcggtccaactgccatatctacgctcaggtattt
tcggattgtggcactaaggtcctcgtcgcggcttccaccgctgaagggaatgtgcgtgcg
caggttgccaatggcggcaatgtcgaggccgcaaaactggtaggcaagctgatcgctgag
cgggctttggctgccggtattgatcaggttgcattcgaccggtcaggctttcactatcac
ggccgcgtcaaggcgctggccgaggcggctcgcgaaggcggcctcaagttctaa

DBGET integrated database retrieval system