Desulfobulbus oligotrophicus: HP555_08850 Help Entry HP555_08850       CDS       T06967                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dog  Desulfobulbus oligotrophicus Pathway dog00020   Citrate cycle (TCA cycle) dog00720   Other carbon fixation pathways dog01100   Metabolic pathways dog01110   Biosynthesis of secondary metabolites dog01120   Microbial metabolism in diverse environments dog01200   Carbon metabolism dog01210   2-Oxocarboxylic acid metabolism Module dog_M00009   Citrate cycle (TCA cycle, Krebs cycle) dog_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dog00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HP555_08850   09102 Energy metabolism    00720 Other carbon fixation pathways     HP555_08850 Enzymes [BR:dog01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HP555_08850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_6 LdpA_Fe-S-bd Fer4_10 Fer4_4 Fer4_9 Fer4_8 Fer4_16 Fer4_17 Fer4_3 Fer4_13 Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  QQG65967 UniProt:  A0A7T5VDM9 LinkDB All DBs Position 1965198..1965473 Genome browser AA seq 91 aa AA seqDB search MTFWRVPLDAQEIQVTRGMVTIIEDRCKGCGYCIEFCPRHILQFSGHFNRKGYHPPVVTK SEECVNCHFCEIICPEFAIFSVEFEPDTAKS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgacattttggcgagtaccccttgatgcccaggagattcaggtcaccagggggatggtc accatcattgaagatcgctgcaaagggtgcggctactgtatcgagttctgccccaggcac attctgcagttcagcgggcatttcaatcgtaaggggtaccatccaccggtggtcacgaag tcggaggagtgtgtcaactgtcatttttgtgaaattatctgtccggagttcgctattttt tcggttgaatttgagccggacaccgccaaaagttaa

DBGET integrated database retrieval system