Desulfobulbus oligotrophicus: HP555_11950 Help Entry HP555_11950       CDS       T06967                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dog  Desulfobulbus oligotrophicus Pathway dog01100   Metabolic pathways dog01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dog00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HP555_11950 (acpP)    00074 Mycolic acid biosynthesis     HP555_11950 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HP555_11950 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QQG66528 UniProt:  A0A7T6ARG7 LinkDB All DBs Position complement(2597047..2597280) Genome browser AA seq 77 aa AA seqDB search MAVEDKMIDIIVEQLSVDRDKVVPAASFVDDLGADSLDLVELIMAMEEEFDVEIPDEEAE KIVTVQNAIDFVAKIQG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggctgttgaagataaaatgattgatatcattgtggaacaattaagcgttgatcgtgat aaggttgttccggctgcttcttttgttgacgatcttggtgccgactctctggatctggtt gaattgatcatggccatggaagaggaatttgatgttgaaattccggatgaagaggcggaa aaaatcgttaccgtacaaaatgctattgatttcgtagcaaaaattcaaggctga

DBGET integrated database retrieval system