KEGG   Desulfobulbus oligotrophicus: HP555_13595
Entry
HP555_13595       CDS       T06967                                 
Name
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K11358  aspartate aminotransferase [EC:2.6.1.1]
Organism
dog  Desulfobulbus oligotrophicus
Pathway
dog00220  Arginine biosynthesis
dog00250  Alanine, aspartate and glutamate metabolism
dog00270  Cysteine and methionine metabolism
dog00330  Arginine and proline metabolism
dog00350  Tyrosine metabolism
dog00360  Phenylalanine metabolism
dog00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dog00401  Novobiocin biosynthesis
dog01100  Metabolic pathways
dog01110  Biosynthesis of secondary metabolites
dog01210  2-Oxocarboxylic acid metabolism
dog01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dog00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HP555_13595
   00270 Cysteine and methionine metabolism
    HP555_13595
   00220 Arginine biosynthesis
    HP555_13595
   00330 Arginine and proline metabolism
    HP555_13595
   00350 Tyrosine metabolism
    HP555_13595
   00360 Phenylalanine metabolism
    HP555_13595
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HP555_13595
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    HP555_13595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dog01007]
    HP555_13595
Enzymes [BR:dog01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     HP555_13595
Amino acid related enzymes [BR:dog01007]
 Aminotransferase (transaminase)
  Class I
   HP555_13595
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase
Other DBs
NCBI-ProteinID: QQG66823
UniProt: A0A7T5VF87
LinkDB
Position
complement(3003612..3004799)
AA seq 395 aa
MSGVAKKMKAFAEKSSWIRKMFEEGAKMKAEFGPDKVFDFSIGNPDVPPPPKFYTVLREL
AQDEQPGIHGYMPNAGYPFVREALAGRLGGEQGVSFSANDILMTCGAAGGLNVIFKALLD
PGDEVIILAPFFVEYHFYIDNHGGVAKVVATDSEFNLDLKAIEAALTAKTKVVLINSPNN
PTGQIYSAASLRELGRLLDTAGERFGTSIYLVSDEPYRNIVFDGNEVPALMPVTTNTIIA
SSYSKELSLPGERIGYLAVHPEMAEKEAVIGALTLANRILGFVNAPALMQRAVAQLQNVS
AENSVYARRLEVFCKVLDEAGMSYVRPKGAFYLFPQTPIDDVEFCRLLTAEKILAVPGRG
FGLPGHIRLAFCVDEKVIAGSSEGFKRAMAAATQK
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgagcggtgttgccaaaaaaatgaaggcgtttgcagagaaatcctcctggattcggaag
atgtttgaagagggagcaaagatgaaagccgaattcggaccggacaaggtgtttgacttc
agtatcggtaatccggatgtgccgccgccgccgaaattttatactgtccttcgtgaattg
gcccaggatgaacagcccggtatccatgggtatatgcccaatgccggctacccgttcgtc
cgggaggctttggccgggcgtcttggtggtgagcagggggtcagcttcagtgcaaatgat
attctgatgacctgtggtgcagctggtgggctgaatgtgatttttaaggccctgctggat
cccggtgatgaggtgattatcctggcgccgttttttgttgagtatcatttttatattgat
aaccatggcggtgttgccaaggtggttgccactgactcggagttcaatctcgatttaaag
gcgattgaagcggctctgactgcaaaaaccaaggttgtgctcatcaactcacccaacaac
cccaccgggcagatctactccgcagcctctctccgagaattgggacgcttactggatact
gccggtgaacgtttcggcacctcgatctatctggtttccgacgaaccgtatcgcaacatc
gtctttgatgggaatgaagtaccggcgctgatgccggtgaccaccaatactatcatagct
tcatcgtattccaaggaactgtctctgcccggtgaacgaatcggctatcttgccgtgcat
ccggagatggcggagaaagaggcagtgatcggcgccttgacgttagcaaaccgcattctc
ggctttgtcaacgccccggctcttatgcagcgggcagtggcacagctgcagaatgtatca
gctgagaactctgtttatgctcgacggctcgaggtcttttgcaaggtgctggatgaagcc
ggtatgtcctatgtgcgtcccaaaggggcattttatctctttccacagacaccgatcgat
gatgtggagttctgccggctcttgaccgctgaaaagattctggcggtacctgggcgggga
ttcggtctgcccgggcatatccgactggccttctgtgttgatgagaaagttattgccggg
tcatccgaggggtttaaacgagcgatggcagcggcaacacaaaaatag

DBGET integrated database retrieval system