KEGG   Desulfosudis oleivorans: Dole_0724
Entry
Dole_0724         CDS       T00610                                 
Name
(GenBank) ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
dol  Desulfosudis oleivorans
Pathway
dol03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dol00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dole_0724
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dol03011]
    Dole_0724
Ribosome [BR:dol03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Dole_0724
  Bacteria
    Dole_0724
  Archaea
    Dole_0724
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-ProteinID: ABW66534
UniProt: A8ZV73
LinkDB
Position
848065..848439
AA seq 124 aa
MGAANKKQELRLKRKARIRKKIAGTPERPRLSIFRSARHIYAQLIDDTKGVTFVTASSNE
PDVKNNTELSGKNKSEVAVFVGKLIAGRAKDKGISSVVFDRGGFVYHGRVKAVSDGAREG
GLNF
NT seq 375 nt   +upstreamnt  +downstreamnt
atgggtgctgcaaacaaaaaacaggagttgcggttaaaaagaaaggccagaatccggaaa
aagattgcgggtaccccggagcggccgcggttgagcatattcagaagcgcgcggcacata
tacgcgcagctgatcgacgacacaaagggcgtgacctttgtgaccgcatccagtaatgaa
ccggatgtgaagaacaatacggaactgtcgggcaagaacaagtccgaggtggcggtgttc
gtgggcaaactgattgccgggcgcgccaaggacaaaggcatctcctcggtggtgttcgac
aggggcggatttgtatatcacgggcgggtcaaggcggtttccgacggggcccgtgaaggc
ggcctgaatttttaa

DBGET integrated database retrieval system