Desulfosudis oleivorans: Dole_0724
Help
Entry
Dole_0724 CDS
T00610
Name
(GenBank) ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
dol
Desulfosudis oleivorans
Pathway
dol03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
dol00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
Dole_0724
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
dol03011
]
Dole_0724
Ribosome [BR:
dol03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
Dole_0724
Bacteria
Dole_0724
Archaea
Dole_0724
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
ABW66534
UniProt:
A8ZV73
LinkDB
All DBs
Position
848065..848439
Genome browser
AA seq
124 aa
AA seq
DB search
MGAANKKQELRLKRKARIRKKIAGTPERPRLSIFRSARHIYAQLIDDTKGVTFVTASSNE
PDVKNNTELSGKNKSEVAVFVGKLIAGRAKDKGISSVVFDRGGFVYHGRVKAVSDGAREG
GLNF
NT seq
375 nt
NT seq
+upstream
nt +downstream
nt
atgggtgctgcaaacaaaaaacaggagttgcggttaaaaagaaaggccagaatccggaaa
aagattgcgggtaccccggagcggccgcggttgagcatattcagaagcgcgcggcacata
tacgcgcagctgatcgacgacacaaagggcgtgacctttgtgaccgcatccagtaatgaa
ccggatgtgaagaacaatacggaactgtcgggcaagaacaagtccgaggtggcggtgttc
gtgggcaaactgattgccgggcgcgccaaggacaaaggcatctcctcggtggtgttcgac
aggggcggatttgtatatcacgggcgggtcaaggcggtttccgacggggcccgtgaaggc
ggcctgaatttttaa
DBGET
integrated database retrieval system