Desulfosudis oleivorans: Dole_2083 Help Entry Dole_2083         CDS       T00610                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dol  Desulfosudis oleivorans Pathway dol01100   Metabolic pathways dol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dole_2083    00074 Mycolic acid biosynthesis     Dole_2083   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dole_2083 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABW67887 UniProt:  A8ZTV4 LinkDB All DBs Position complement(2533770..2534000) Genome browser AA seq 76 aa AA seqDB search MSIEDKVKRILAERLEVDPSEIRPDAEFISDLGADSLDIVELLMSLEDEFDIEISDDEAE QIMTVKDAVEFITKRL NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtccattgaagataaggttaaacgcattctggccgagcggcttgaggtcgatcccagt gaaatccggccggatgccgagtttatcagcgacctgggcgccgattccctggatattgtg gagctgctcatgtccctggaggacgagtttgatatcgagatatccgacgatgaggccgag cagatcatgacggtgaaggacgcggtggagtttatcacaaaacggctgtag

DBGET integrated database retrieval system