KEGG   Desulfosudis oleivorans: Dole_2741
Entry
Dole_2741         CDS       T00610                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
dol  Desulfosudis oleivorans
Pathway
dol00770  Pantothenate and CoA biosynthesis
dol01100  Metabolic pathways
dol01240  Biosynthesis of cofactors
Module
dol_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:dol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Dole_2741
Enzymes [BR:dol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Dole_2741
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig Pantoate_ligase
Other DBs
NCBI-ProteinID: ABW68544
UniProt: A8ZXR7
LinkDB
Position
3309536..3310042
AA seq 168 aa
MKIAIYPGSFDPVTNGHIDIIQRGRHLFDKIIVSILLNPGKKALFSLDERLDMLTESLKD
IDGVEVDSFAGLLIDYAERKNAKAILRGMRAVSDFEYEFQMALMNRRLNRDIQTVFLMTG
MRWIYTSSSIIKEAATFGGDISGMVPAIVEKKLEEKIGYVVNHKKAED
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaaaatcgccatctacccgggttcctttgatccggtcaccaacggtcacatcgacatc
attcagcggggacgtcacctgtttgacaaaatcatcgtgtcgattcttctcaatcccggg
aaaaaagcactcttctcccttgatgaacggctggacatgctgaccgaaagtctgaaggat
attgacggtgtggaggtggactcttttgccggcctgctcatcgactatgccgagcggaaa
aacgcgaaggccattctccggggcatgcgggccgtatccgactttgagtacgaatttcag
atggccctgatgaaccggcggctcaaccgggatattcagacggtgtttttgatgaccggc
atgcggtggatttataccagctcttccattatcaaggaggcggccacctttggcggcgac
atcagcggcatggtgccggcgatcgtggaaaaaaagctggaagaaaagatcggatacgtc
gtcaaccacaaaaaggccgaggactaa

DBGET integrated database retrieval system