Marivivens sp. JLT3646: BSK21_07775 Help Entry BSK21_07775       CDS       T04589                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism don  Marivivens sp. JLT3646 Pathway don01100   Metabolic pathways don01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:don00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSK21_07775    00074 Mycolic acid biosynthesis     BSK21_07775   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSK21_07775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  APO86938 UniProt:  A0AA34SDL8 LinkDB All DBs Position complement(1560579..1560812) Genome browser AA seq 77 aa AA seqDB search MSDVADRVRKIVVEHLGVEEEKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQSFGDAVKFISEAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgctgatcgtgtgcgcaaaatcgtagttgagcacctgggtgttgaagag gaaaaagtgaccgagaatgcatcgttcatcgatgacctcggcgcagacagcctcgacacc gtagagctggtaatggctttcgaagaagaattcggtatcgaaatcccggacgacgctgca gagaccattcagtccttcggcgacgctgtgaaattcatctctgaagctcagtaa

DBGET integrated database retrieval system