Marivivens sp. JLT3646: BSK21_14780 Help Entry BSK21_14780       CDS       T04589                                  Name (GenBank) hypothetical protein   KO K02395   peptidoglycan hydrolase FlgJ Organism don  Marivivens sp. JLT3646 Pathway don02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:don00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     BSK21_14780  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:don02035]     BSK21_14780 Bacterial motility proteins [BR:don02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     BSK21_14780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  APO88442 UniProt:  A0AA34SGD1 LinkDB All DBs Position complement(2945008..2945277) Genome browser AA seq 89 aa AA seqDB search MIPLLTKQPSAVSPTSQLRTVANEMEAAFLAEMLKYSGLGDTSDAFGAGAGGEHFASFLR EEQARIMVEGGGIGLSESIFRALSERPHD NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgatcccccttttgaccaaacagccaagcgcagtcagtccgacctcacaattgcgaacg gtcgccaatgaaatggaagccgcgtttttggcagaaatgctgaaatattcgggacttggc gatacgtcagacgcgtttggtgcgggagctggcggcgaacatttcgcgtcatttctgcgc gaagaacaggcccgaattatggtcgaaggcggcggcatcggcctctcagaatcgatcttc cgcgccctttcggagagaccccatgactga

DBGET integrated database retrieval system