Dipodomys ordii (Ord's kangaroo rat): 105981912 Help Entry 105981912         CDS       T07834                                  Symbol Nme3 Name (RefSeq) nucleoside diphosphate kinase 3   KO K00940   nucleoside-diphosphate kinase [EC:2.7.4.6] Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord00230   Purine metabolism dord00240   Pyrimidine metabolism dord00983   Drug metabolism - other enzymes dord01100   Metabolic pathways dord01232   Nucleotide metabolism dord01240   Biosynthesis of cofactors Module dord_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP dord_M00050   Guanine ribonucleotide biosynthesis, IMP => GDP,GTP dord_M00052   Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP dord_M00053   Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP dord_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:dord00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     105981912 (Nme3)    00240 Pyrimidine metabolism     105981912 (Nme3)   09111 Xenobiotics biodegradation and metabolism    00983 Drug metabolism - other enzymes     105981912 (Nme3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dord04131]     105981912 (Nme3) Enzymes [BR:dord01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.6  nucleoside-diphosphate kinase      105981912 (Nme3) Membrane trafficking [BR:dord04131]  Exocytosis   Calcium ion-dependent exocytosis    Kinases and associated proteins     105981912 (Nme3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NDK Motif Other DBs NCBI-GeneID:  105981912 NCBI-ProteinID:  XP_012866716 UniProt:  A0A1S3EQP7 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MGSGPGAGRGAGARGLHPQASEELLREHYAELRGRPFFGRLLDYMRSGPVVAMVRNLVHG SDSPESARREIALWFGADELLCGEDGAARWLHE NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggggtcggggccgggtgcgggtcggggcgctggcgcacgcggcctccacccccaggcc tccgaggagctgctgcgcgagcactacgccgagctgcgcgggcgccccttcttcggccgc ctgctggactacatgcgctcgggccccgtggtggccatggtgaggaacctggtccacggc agcgactctccggagagcgcccgccgggagatcgcgctgtggttcggcgcggacgaactg ctgtgcggggaggacggcgccgcgcgctggctgcacgagtag

DBGET integrated database retrieval system