Dipodomys ordii (Ord's kangaroo rat): 105983419 Help Entry 105983419         CDS       T07834                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04060   Cytokine-cytokine receptor interaction dord04061   Viral protein interaction with cytokine and cytokine receptor dord04062   Chemokine signaling pathway dord04620   Toll-like receptor signaling pathway dord05142   Chagas disease dord05163   Human cytomegalovirus infection dord05323   Rheumatoid arthritis dord05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105983419    04061 Viral protein interaction with cytokine and cytokine receptor     105983419  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105983419    04062 Chemokine signaling pathway     105983419  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     105983419   09174 Infectious disease: parasitic    05142 Chagas disease     105983419   09163 Immune disease    05323 Rheumatoid arthritis     105983419   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105983419  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     105983419    00536 Glycosaminoglycan binding proteins [BR:dord00536]     105983419 Cytokines and neuropeptides [BR:dord04052]  Cytokines   Chemokines    105983419 Glycosaminoglycan binding proteins [BR:dord00536]  Heparan sulfate / Heparin   Chemokines    105983419 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  105983419 NCBI-ProteinID:  XP_012868729 UniProt:  A0A1S3EXR2 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MKVSVAAFAVLLCAMALCHQASPAPLGADTPTACCFSYVKHQIPRKFIVDYFETNGQCSQ PGVIFLTKKNRQVCADPRQAWVQEYISDLKQEAEGAKRQQETQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgtggctgcctttgctgtcctgctttgcgccatggccctctgtcaccag gcctcccctgcaccacttggtgctgacactccaaccgcctgctgcttctcctacgtcaag caccagattcctcgtaaattcatagttgattattttgagaccaacggtcagtgttcccag ccgggcgtcatcttcctaaccaagaaaaaccggcaggtctgtgctgacccccgccaggcc tgggtgcaagagtacatctctgacctgaagcaggaagctgaaggagcaaagagacagcag gagacccagtga

DBGET integrated database retrieval system