Dipodomys ordii (Ord's kangaroo rat): 105984791 Help Entry 105984791         CDS       T07834                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04613   Neutrophil extracellular trap formation dord05034   Alcoholism dord05202   Transcriptional misregulation in cancer dord05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dord00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105984791  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105984791   09163 Immune disease    05322 Systemic lupus erythematosus     105984791   09165 Substance dependence    05034 Alcoholism     105984791  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dord03036]     105984791   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dord04147]     105984791 Chromosome and associated proteins [BR:dord03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105984791 Exosome [BR:dord04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105984791 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  105984791 NCBI-ProteinID:  XP_012870527 UniProt:  A0A1S3GD22 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgcacgaagcagacggcccgcaagtcgaccggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaaaaagccgcac cgctaccggccgggcaccgtggccctgcgcgagatccggcgctaccagaagtcgacggag ctgctcatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag acggacctgcgcttccagagctcggcggtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgttcgaggacactaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcccgccgcatccgcggggagcgcgcttaa

DBGET integrated database retrieval system