Dipodomys ordii (Ord's kangaroo rat): 105988976 Help Entry 105988976         CDS       T07834                                  Name (RefSeq) interferon alpha-2-like   KO K05414   interferon alpha Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04060   Cytokine-cytokine receptor interaction dord04151   PI3K-Akt signaling pathway dord04217   Necroptosis dord04620   Toll-like receptor signaling pathway dord04621   NOD-like receptor signaling pathway dord04622   RIG-I-like receptor signaling pathway dord04623   Cytosolic DNA-sensing pathway dord04630   JAK-STAT signaling pathway dord04650   Natural killer cell mediated cytotoxicity dord04936   Alcoholic liver disease dord05152   Tuberculosis dord05160   Hepatitis C dord05161   Hepatitis B dord05162   Measles dord05163   Human cytomegalovirus infection dord05164   Influenza A dord05165   Human papillomavirus infection dord05167   Kaposi sarcoma-associated herpesvirus infection dord05168   Herpes simplex virus 1 infection dord05169   Epstein-Barr virus infection dord05170   Human immunodeficiency virus 1 infection dord05171   Coronavirus disease - COVID-19 dord05200   Pathways in cancer dord05320   Autoimmune thyroid disease dord05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105988976    04151 PI3K-Akt signaling pathway     105988976   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105988976  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105988976  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105988976    04621 NOD-like receptor signaling pathway     105988976    04622 RIG-I-like receptor signaling pathway     105988976    04623 Cytosolic DNA-sensing pathway     105988976    04650 Natural killer cell mediated cytotoxicity     105988976  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105988976   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105988976    05161 Hepatitis B     105988976    05160 Hepatitis C     105988976    05171 Coronavirus disease - COVID-19     105988976    05164 Influenza A     105988976    05162 Measles     105988976    05168 Herpes simplex virus 1 infection     105988976    05163 Human cytomegalovirus infection     105988976    05167 Kaposi sarcoma-associated herpesvirus infection     105988976    05169 Epstein-Barr virus infection     105988976    05165 Human papillomavirus infection     105988976   09171 Infectious disease: bacterial    05152 Tuberculosis     105988976   09163 Immune disease    05320 Autoimmune thyroid disease     105988976   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105988976   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105988976  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     105988976 Cytokines and neuropeptides [BR:dord04052]  Cytokines   Interferons    105988976 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  105988976 NCBI-ProteinID:  XP_012876219 UniProt:  A0A1S3FJL0 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MPLPLAFLVTLVVLSCRATCSLGCELPPTHSLGNRRALLLLGQMRRVSLFSCLKDRKDFG FPQEALDGEQVHKAQAITVLHEMTRQIYSLFSTKTWPAPWEKSLVDKLCTGLHEQLQELR ACLSREVGEQEPAMVLEDSTLAVSKHFHRISLYLQEKKFSPCAWEVVRAEIMRYFSSAVD LQEYLRSH NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgcccttgcccttggccttcctggtgaccctggtggtgctcagctgcagggcaacctgc tctctgggctgtgagctgcctcccacccacagcctgggcaacagaagagccctgctcctc ctgggacagatgaggagagtctcccttttctcctgcctgaaggacagaaaggactttgga ttcccccaggaggcactggatggagagcaggtccacaaggctcaagccatcactgtcctc catgagatgaccaggcagatctacagcctcttcagcacaaagacctggcctgccccttgg gagaagagccttgtggacaaactgtgcactggcctccatgagcagctgcaggagctgaga gcctgcctgagccgggaggtgggagagcaggagcctgccatggtgcttgaggactccaca ctggctgtgagcaaacacttccacaggatctctctctacctgcaagagaagaagttcagc ccttgtgcctgggaggttgtcagggcagaaatcatgagatacttctcttcagcagtagac ttgcaggagtatttgagaagccattga

DBGET integrated database retrieval system