Dipodomys ordii (Ord's kangaroo rat): 105989131 Help Entry 105989131         CDS       T07834                                  Name (RefSeq) glutathione S-transferase P-like   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord00480   Glutathione metabolism dord00980   Metabolism of xenobiotics by cytochrome P450 dord00982   Drug metabolism - cytochrome P450 dord00983   Drug metabolism - other enzymes dord01100   Metabolic pathways dord01524   Platinum drug resistance dord05200   Pathways in cancer dord05204   Chemical carcinogenesis - DNA adducts dord05215   Prostate cancer dord05225   Hepatocellular carcinoma dord05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dord00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     105989131   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     105989131    00982 Drug metabolism - cytochrome P450     105989131    00983 Drug metabolism - other enzymes     105989131  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105989131    05204 Chemical carcinogenesis - DNA adducts     105989131   09162 Cancer: specific types    05225 Hepatocellular carcinoma     105989131    05215 Prostate cancer     105989131   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105989131   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105989131  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dord02000]     105989131 Enzymes [BR:dord01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      105989131 Transporters [BR:dord02000]  Other transporters   Pores ion channels [TC:1]    105989131 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  105989131 NCBI-ProteinID:  XP_012876416 Ensembl:  ENSDORG00000024771 UniProt:  A0A1S3FIS6 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MPPYTLVYFPIRGRCEPMRMLLADQGQTWKEEVVTREDWRQGTVKASCLFGQLPKFQDGD LTLYQSNAILRHLARTFGLYGKDQREAALLDMVNDGMEDITNRFVQLLHNNPEEGKAQYL KELPGYLKPFETLLAQNQGGQAFIVGDQISFADYRLLSLLLNFQVLAPGCLDDFPLLSAY AVRLSGRPKLKAFLASPEHINRPISTFLKK NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccctcgtctactttcccatccgagggcgctgcgagcccatgcgcatg ctgctagctgaccagggccagacctggaaggaggaggtggtgacccgcgaagactggagg cagggcacagtcaaggcctcctgccttttcggacagctccccaagttccaggatggagac ctcaccctgtaccagtccaatgccatcctgcggcacctggcccgcacctttgggctctat ggcaaagatcagcgagaggcagcactgctagacatggtgaatgacggaatggaggacatc accaaccgctttgtccaactcctccacaataaccctgaggagggcaaggcccaatatttg aaggagcttcctgggtacctgaagccttttgaaactctgctggcccagaaccaggggggc caggctttcatcgtgggagatcagatctccttcgcagactaccgcctgctgagcctgctg ctgaacttccaggtcttggctcctggctgcctggatgatttccccttgctctcggcttac gccgtacgcctcagcggccggccgaagctcaaggccttcctggcttctcctgagcacatc aatcgccctatctctacattcctcaagaagtga

DBGET integrated database retrieval system