Dipodomys ordii (Ord's kangaroo rat): 105989886 Help Entry 105989886         CDS       T07834                                  Symbol Il2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04060   Cytokine-cytokine receptor interaction dord04061   Viral protein interaction with cytokine and cytokine receptor dord04151   PI3K-Akt signaling pathway dord04625   C-type lectin receptor signaling pathway dord04630   JAK-STAT signaling pathway dord04658   Th1 and Th2 cell differentiation dord04659   Th17 cell differentiation dord04660   T cell receptor signaling pathway dord04672   Intestinal immune network for IgA production dord04940   Type I diabetes mellitus dord05135   Yersinia infection dord05142   Chagas disease dord05162   Measles dord05166   Human T-cell leukemia virus 1 infection dord05171   Coronavirus disease - COVID-19 dord05200   Pathways in cancer dord05320   Autoimmune thyroid disease dord05321   Inflammatory bowel disease dord05330   Allograft rejection dord05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105989886 (Il2)    04151 PI3K-Akt signaling pathway     105989886 (Il2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105989886 (Il2)    04061 Viral protein interaction with cytokine and cytokine receptor     105989886 (Il2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105989886 (Il2)    04660 T cell receptor signaling pathway     105989886 (Il2)    04658 Th1 and Th2 cell differentiation     105989886 (Il2)    04659 Th17 cell differentiation     105989886 (Il2)    04672 Intestinal immune network for IgA production     105989886 (Il2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105989886 (Il2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105989886 (Il2)    05171 Coronavirus disease - COVID-19     105989886 (Il2)    05162 Measles     105989886 (Il2)   09171 Infectious disease: bacterial    05135 Yersinia infection     105989886 (Il2)   09174 Infectious disease: parasitic    05142 Chagas disease     105989886 (Il2)   09163 Immune disease    05320 Autoimmune thyroid disease     105989886 (Il2)    05321 Inflammatory bowel disease     105989886 (Il2)    05330 Allograft rejection     105989886 (Il2)    05332 Graft-versus-host disease     105989886 (Il2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     105989886 (Il2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     105989886 (Il2)    00536 Glycosaminoglycan binding proteins [BR:dord00536]     105989886 (Il2) Cytokines and neuropeptides [BR:dord04052]  Cytokines   Interleukins    105989886 (Il2) Glycosaminoglycan binding proteins [BR:dord00536]  Heparan sulfate / Heparin   Cytokines    105989886 (Il2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Serglycin MpAgo_N-like Motif Other DBs NCBI-GeneID:  105989886 NCBI-ProteinID:  XP_012877594 Ensembl:  ENSDORG00000014968 UniProt:  A0A1S3FNJ6 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MYKTQLLLCIALGLVLVINSAPTSAPMKEARGQLEQVLLDLQVLLKAVNSDKNLKLSRML TFKFYMPKKATDLKHLQCLEEELKPLEGVLNLAQSNNFHLKDSRDLISNINVTVLKLKGS ETFICDYEDKTATIVEFLNRWIIFCQGIISTLT NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaacacagctcctgctttgcattgcactaggtctcgtacttgtcataaacagt gcacctacttcagcccctatgaaggaagctcgaggacaactggagcaagtactgctggac ctacaggtgcttttgaaagcagttaatagtgacaagaatctcaaactgtccaggatgctc acgtttaaattttacatgcccaagaaggccacagatttgaagcatcttcagtgcctagaa gaagaactcaaacctctggagggggtgctaaatttagctcaaagcaacaacttccacttg aaagacagcagagatttaatcagcaatatcaatgttacagttctgaaactaaagggatct gaaacattcatatgtgactatgaagacaagacagcaaccattgtagaatttctgaacaga tggattatcttttgtcaaggcatcatctcaacacttacttga

DBGET integrated database retrieval system