Dipodomys ordii (Ord's kangaroo rat): 105990193 Help Entry 105990193         CDS       T07834                                  Symbol Rab1a Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04140   Autophagy - animal dord05014   Amyotrophic lateral sclerosis dord05022   Pathways of neurodegeneration - multiple diseases dord05134   Legionellosis Brite KEGG Orthology (KO) [BR:dord00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105990193 (Rab1a)  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     105990193 (Rab1a)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105990193 (Rab1a)    05022 Pathways of neurodegeneration - multiple diseases     105990193 (Rab1a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dord04131]     105990193 (Rab1a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dord04147]     105990193 (Rab1a)    04031 GTP-binding proteins [BR:dord04031]     105990193 (Rab1a) Membrane trafficking [BR:dord04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     105990193 (Rab1a)  Autophagy   Other autophagy associated proteins     105990193 (Rab1a) Exosome [BR:dord04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105990193 (Rab1a)   Exosomal proteins of other body fluids (saliva and urine)    105990193 (Rab1a)   Exosomal proteins of colorectal cancer cells    105990193 (Rab1a) GTP-binding proteins [BR:dord04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     105990193 (Rab1a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA ABC_tran AAA_7 PduV-EutP AAA_16 LANC_like AAA_29 Septin AAA_22 AAA_5 CRAL_TRIO_2 Motif Other DBs NCBI-GeneID:  105990193 NCBI-ProteinID:  XP_012877979 Ensembl:  ENSDORG00000028628 UniProt:  A0A1S3FPM5 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA TAGGAEKSNVKIQSTPVKQSGGGCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactct ggggttggaaagtcttgcctccttcttaggtttgcagatgatacatatacagaaagctac atcagcacaattggtgtggatttcaaaataagaactatagagttagatggcaaaacaatc aagcttcaaatatgggacacagcaggccaagaaagatttcgaacaatcacttccagctat tacagaggagcccatggcatcatcgtagtgtatgatgtgacagatcaggagtcattcaat aatgtcaaacagtggcttcaagaaatagatcgttatgccagtgagaacgtcaacaagttg ttggtaggcaacaagtgtgacctgaccactaagaaagtagtagactacacaacagcaaag gaatttgctgattcccttggaatcccatttttggaaaccagtgctaagaatgcaacgaat gtagaacagtctttcatgacgatggcagcagagattaaaaagcgaatgggccctggagca acagctggcggtgcagagaagtccaatgttaaaattcagagcactccagtgaagcagtca ggtggaggttgctgctaa

DBGET integrated database retrieval system