Dipodomys ordii (Ord's kangaroo rat): 105990787 Help Entry 105990787         CDS       T07834                                  Symbol Ppp3r2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04010   MAPK signaling pathway dord04020   Calcium signaling pathway dord04022   cGMP-PKG signaling pathway dord04114   Oocyte meiosis dord04218   Cellular senescence dord04310   Wnt signaling pathway dord04360   Axon guidance dord04370   VEGF signaling pathway dord04380   Osteoclast differentiation dord04625   C-type lectin receptor signaling pathway dord04650   Natural killer cell mediated cytotoxicity dord04658   Th1 and Th2 cell differentiation dord04659   Th17 cell differentiation dord04660   T cell receptor signaling pathway dord04662   B cell receptor signaling pathway dord04720   Long-term potentiation dord04724   Glutamatergic synapse dord04921   Oxytocin signaling pathway dord04922   Glucagon signaling pathway dord04924   Renin secretion dord05010   Alzheimer disease dord05014   Amyotrophic lateral sclerosis dord05020   Prion disease dord05022   Pathways of neurodegeneration - multiple diseases dord05031   Amphetamine addiction dord05152   Tuberculosis dord05163   Human cytomegalovirus infection dord05166   Human T-cell leukemia virus 1 infection dord05167   Kaposi sarcoma-associated herpesvirus infection dord05170   Human immunodeficiency virus 1 infection dord05235   PD-L1 expression and PD-1 checkpoint pathway in cancer dord05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105990787 (Ppp3r2)    04310 Wnt signaling pathway     105990787 (Ppp3r2)    04370 VEGF signaling pathway     105990787 (Ppp3r2)    04020 Calcium signaling pathway     105990787 (Ppp3r2)    04022 cGMP-PKG signaling pathway     105990787 (Ppp3r2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     105990787 (Ppp3r2)    04218 Cellular senescence     105990787 (Ppp3r2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105990787 (Ppp3r2)    04650 Natural killer cell mediated cytotoxicity     105990787 (Ppp3r2)    04660 T cell receptor signaling pathway     105990787 (Ppp3r2)    04658 Th1 and Th2 cell differentiation     105990787 (Ppp3r2)    04659 Th17 cell differentiation     105990787 (Ppp3r2)    04662 B cell receptor signaling pathway     105990787 (Ppp3r2)   09152 Endocrine system    04922 Glucagon signaling pathway     105990787 (Ppp3r2)    04921 Oxytocin signaling pathway     105990787 (Ppp3r2)    04924 Renin secretion     105990787 (Ppp3r2)   09156 Nervous system    04724 Glutamatergic synapse     105990787 (Ppp3r2)    04720 Long-term potentiation     105990787 (Ppp3r2)   09158 Development and regeneration    04360 Axon guidance     105990787 (Ppp3r2)    04380 Osteoclast differentiation     105990787 (Ppp3r2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105990787 (Ppp3r2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105990787 (Ppp3r2)    05170 Human immunodeficiency virus 1 infection     105990787 (Ppp3r2)    05163 Human cytomegalovirus infection     105990787 (Ppp3r2)    05167 Kaposi sarcoma-associated herpesvirus infection     105990787 (Ppp3r2)   09171 Infectious disease: bacterial    05152 Tuberculosis     105990787 (Ppp3r2)   09164 Neurodegenerative disease    05010 Alzheimer disease     105990787 (Ppp3r2)    05014 Amyotrophic lateral sclerosis     105990787 (Ppp3r2)    05020 Prion disease     105990787 (Ppp3r2)    05022 Pathways of neurodegeneration - multiple diseases     105990787 (Ppp3r2)   09165 Substance dependence    05031 Amphetamine addiction     105990787 (Ppp3r2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105990787 (Ppp3r2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dord01009]     105990787 (Ppp3r2) Protein phosphatases and associated proteins [BR:dord01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105990787 (Ppp3r2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  105990787 NCBI-ProteinID:  XP_012878729 UniProt:  A0A1S3FRR9 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPSEMCSHFDQDELRRLGKRFKKIDLDKSGALSVEEFLSLPQLKQNPLVKRVVE IFDVDGNGVVDFREFIMGASQFSVKGAEEEKLRFAFRIYDIDNDGFISNGELFQVLKMMV GDNLKDWQLQQLVDKTIIVLDKDGDGRISFEEFCNVVRGLEVHKKLVVMV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaacgaggccagctacccatcggagatgtgctctcactttgaccaagatgaactc agacgtctgggcaagagattcaagaagatagacctggacaagtcgggcgcgctgagcgtg gaggagttcctgtcgctgccccagctgaagcagaacccgctggtgaagcgagtggtggag atcttcgacgtggatggcaacggcgtggtggacttccgagagttcatcatgggagcctcc cagttcagcgtgaagggggctgaggaggagaagctgaggttcgccttccgaatctatgac atagacaacgacggcttcatttccaacggcgagctcttccaggtgctgaagatgatggtg ggcgacaacctcaaggactggcagctgcagcagctcgtggacaagaccatcatcgtcctg gataaggacggcgatggcagaatatcgtttgaggaattctgcaatgtggttagaggcctg gaggtccacaagaagttggttgtgatggtgtga

DBGET integrated database retrieval system