Dipodomys ordii (Ord's kangaroo rat): 105991774 Help Entry 105991774         CDS       T07834                                  Name (RefSeq) cytochrome c, somatic   KO K08738   cytochrome c Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord00190   Oxidative phosphorylation dord01100   Metabolic pathways dord01524   Platinum drug resistance dord04115   p53 signaling pathway dord04210   Apoptosis dord04215   Apoptosis - multiple species dord04932   Non-alcoholic fatty liver disease dord05010   Alzheimer disease dord05012   Parkinson disease dord05014   Amyotrophic lateral sclerosis dord05016   Huntington disease dord05017   Spinocerebellar ataxia dord05020   Prion disease dord05022   Pathways of neurodegeneration - multiple diseases dord05132   Salmonella infection dord05134   Legionellosis dord05145   Toxoplasmosis dord05152   Tuberculosis dord05160   Hepatitis C dord05161   Hepatitis B dord05162   Measles dord05163   Human cytomegalovirus infection dord05164   Influenza A dord05167   Kaposi sarcoma-associated herpesvirus infection dord05168   Herpes simplex virus 1 infection dord05169   Epstein-Barr virus infection dord05170   Human immunodeficiency virus 1 infection dord05200   Pathways in cancer dord05210   Colorectal cancer dord05222   Small cell lung cancer dord05416   Viral myocarditis dord05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dord00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     105991774  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105991774    04215 Apoptosis - multiple species     105991774    04115 p53 signaling pathway     105991774  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105991774   09162 Cancer: specific types    05210 Colorectal cancer     105991774    05222 Small cell lung cancer     105991774   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105991774    05161 Hepatitis B     105991774    05160 Hepatitis C     105991774    05164 Influenza A     105991774    05162 Measles     105991774    05168 Herpes simplex virus 1 infection     105991774    05163 Human cytomegalovirus infection     105991774    05167 Kaposi sarcoma-associated herpesvirus infection     105991774    05169 Epstein-Barr virus infection     105991774   09171 Infectious disease: bacterial    05132 Salmonella infection     105991774    05134 Legionellosis     105991774    05152 Tuberculosis     105991774   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105991774   09164 Neurodegenerative disease    05010 Alzheimer disease     105991774    05012 Parkinson disease     105991774    05014 Amyotrophic lateral sclerosis     105991774    05016 Huntington disease     105991774    05017 Spinocerebellar ataxia     105991774    05020 Prion disease     105991774    05022 Pathways of neurodegeneration - multiple diseases     105991774   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105991774    05416 Viral myocarditis     105991774   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105991774   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105991774 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  105991774 NCBI-ProteinID:  XP_012879948 Ensembl:  ENSDORG00000029787 UniProt:  A0A1S3FTQ6 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNEE NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccacacc gttgaaaagggaggcaagcacaagactgggcctaatctccatggtctgtttggtcggaag acgggtcaagcagctggattctcttacacagatgccaacaagaacaaaggcatcacctgg ggagaggatacactgatggagtatttggagaatcccaaaaagtacatccctggaacaaaa atgatcttcgctggcattaagaagaagggagaaagggcagatttgatagcttacctcaaa aaagctacaaatgaggaatag

DBGET integrated database retrieval system