Dipodomys ordii (Ord's kangaroo rat): 105993491 Help Entry 105993491         CDS       T07834                                  Symbol Dynlt3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04814   Motor proteins dord05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dord00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     105993491 (Dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105993491 (Dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dord03037]     105993491 (Dynlt3)    04812 Cytoskeleton proteins [BR:dord04812]     105993491 (Dynlt3) Cilium and associated proteins [BR:dord03037]  Motile cilia and associated proteins   Dynein arm    105993491 (Dynlt3) Cytoskeleton proteins [BR:dord04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105993491 (Dynlt3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  105993491 NCBI-ProteinID:  XP_012882217 Ensembl:  ENSDORG00000028646 UniProt:  A0A1S3G2D1 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNADEAHNIVKECIDGVLGGEDYNYNNINQWTASIVEQSLTHLVKLGK AYKYIVTCAVVQRSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccaccgccactgcgacgaggttggcttcaatgctgatgaagcacacaat attgtcaaagagtgtatagatggggttttaggtggtgaagactacaattacaacaatatc aaccagtggactgcaagcatagtggagcagtcactaactcatttggttaagttggggaaa gcttacaagtacatcgtgacttgtgctgtggtccagcgaagtgcatacggctttcacaca gccagctcatgtttttgggataccacttctgacggaacctgtactgtaagatgggagaac cgaaccatgaactgcattgttaatgtttttgccattgcaattgtcctgtaa

DBGET integrated database retrieval system