Dipodomys ordii (Ord's kangaroo rat): 105993854 Help Entry 105993854         CDS       T07834                                  Symbol Rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04072   Phospholipase D signaling pathway dord04140   Autophagy - animal dord04150   mTOR signaling pathway dord04151   PI3K-Akt signaling pathway dord04152   AMPK signaling pathway dord04211   Longevity regulating pathway dord04218   Cellular senescence dord04714   Thermogenesis dord04910   Insulin signaling pathway dord04919   Thyroid hormone signaling pathway dord05163   Human cytomegalovirus infection dord05165   Human papillomavirus infection dord05168   Herpes simplex virus 1 infection dord05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     105993854 (Rheb)    04151 PI3K-Akt signaling pathway     105993854 (Rheb)    04152 AMPK signaling pathway     105993854 (Rheb)    04150 mTOR signaling pathway     105993854 (Rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105993854 (Rheb)   09143 Cell growth and death    04218 Cellular senescence     105993854 (Rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     105993854 (Rheb)    04919 Thyroid hormone signaling pathway     105993854 (Rheb)   09149 Aging    04211 Longevity regulating pathway     105993854 (Rheb)   09159 Environmental adaptation    04714 Thermogenesis     105993854 (Rheb)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     105993854 (Rheb)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     105993854 (Rheb)    05163 Human cytomegalovirus infection     105993854 (Rheb)    05165 Human papillomavirus infection     105993854 (Rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dord04031]     105993854 (Rheb) GTP-binding proteins [BR:dord04031]  Small (monomeric) G-proteins   Ras Family    Rheb     105993854 (Rheb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf STIV_penton_2nd DUF1842 RsgA_GTPase Motif Other DBs NCBI-GeneID:  105993854 NCBI-ProteinID:  XP_012882678 Ensembl:  ENSDORG00000010304 UniProt:  A0A1S3G1J4 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search FLVAFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKV IHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQVRNL NT seq 363 nt NT seq  +upstreamnt  +downstreamnt ttccttgtagctttcacaaagttgatcacagtaaatggacaagaatatcatcttcaactt gtagacaccgctgggcaagatgaatattcgatttttcctcagacatactccatagatatt aatggctatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagtc atccatggcaagttgttggatatggtgggtaaagtgcaaattcctattatgttggttggg aataagaaagacctgcacatggaaagggtgatcagctatgaagaagggaaggctttggca gagtcttggaatgcagcttttttggaatcttctgctaaagaaaatcaggttcggaacctg taa

DBGET integrated database retrieval system