Dipodomys ordii (Ord's kangaroo rat): 105994099 Help Entry 105994099         CDS       T07834                                  Symbol Sod1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04146   Peroxisome dord04213   Longevity regulating pathway - multiple species dord05012   Parkinson disease dord05014   Amyotrophic lateral sclerosis dord05016   Huntington disease dord05020   Prion disease dord05022   Pathways of neurodegeneration - multiple diseases dord05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:dord00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     105994099 (Sod1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     105994099 (Sod1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     105994099 (Sod1)   09164 Neurodegenerative disease    05012 Parkinson disease     105994099 (Sod1)    05014 Amyotrophic lateral sclerosis     105994099 (Sod1)    05016 Huntington disease     105994099 (Sod1)    05020 Prion disease     105994099 (Sod1)    05022 Pathways of neurodegeneration - multiple diseases     105994099 (Sod1) Enzymes [BR:dord01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      105994099 (Sod1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  105994099 NCBI-ProteinID:  XP_012882975 UniProt:  A0A1S3G2T5 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search MALKAVCVLKGDSLVQGIIHFEQQADGPVMVQGTITGLTEGQHGFHVHQFGDNTQGCTSA GPHFNPLSKNHGGPEDQERHVGDLGNVTADKDGTAKVSIKDSMISLTGECSIIGRTMVVS FHTKEDMHSFF NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcgctgaaggccgtgtgcgtgctgaagggcgatagtctggtgcagggcatcatccac ttcgagcagcaggcagatgggccagttatggtacaggggaccattacaggattgactgaa ggccagcatggattccatgtccatcagtttggagataatacacaaggttgtaccagtgca ggtcctcactttaatcctctatccaaaaatcatggtgggccagaagatcaagaaagacat gttggagatctgggcaatgtgactgctgacaaagacggtacagccaaagtgtccatcaaa gactcaatgatctcactcacaggagagtgttccatcattggccgcactatggtggtaagt tttcatacaaaggaggatatgcatagtttcttctaa

DBGET integrated database retrieval system