Dipodomys ordii (Ord's kangaroo rat): 105994295 Help Entry 105994295         CDS       T07834                                  Symbol Rras Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04010   MAPK signaling pathway dord04014   Ras signaling pathway dord04015   Rap1 signaling pathway dord04024   cAMP signaling pathway dord04072   Phospholipase D signaling pathway dord04137   Mitophagy - animal dord04140   Autophagy - animal dord04218   Cellular senescence dord04360   Axon guidance dord04371   Apelin signaling pathway dord04519   Cadherin signaling dord04625   C-type lectin receptor signaling pathway dord04810   Regulation of actin cytoskeleton dord05132   Salmonella infection dord05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105994295 (Rras)    04014 Ras signaling pathway     105994295 (Rras)    04015 Rap1 signaling pathway     105994295 (Rras)    04371 Apelin signaling pathway     105994295 (Rras)    04072 Phospholipase D signaling pathway     105994295 (Rras)    04024 cAMP signaling pathway     105994295 (Rras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     105994295 (Rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105994295 (Rras)    04137 Mitophagy - animal     105994295 (Rras)   09143 Cell growth and death    04218 Cellular senescence     105994295 (Rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105994295 (Rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105994295 (Rras)   09158 Development and regeneration    04360 Axon guidance     105994295 (Rras)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105994295 (Rras)   09171 Infectious disease: bacterial    05132 Salmonella infection     105994295 (Rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dord04031]     105994295 (Rras) GTP-binding proteins [BR:dord04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105994295 (Rras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 AAA_22 Motif Other DBs NCBI-GeneID:  105994295 NCBI-ProteinID:  XP_012883189 Ensembl:  ENSDORG00000014918 UniProt:  A0A1S3G4H8 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDHQSFNEVS KLFTQILRVKDRDDFPVVLVGNKADLESQRQVLRSEALTFSATNHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKNGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggactgggcgggggcggccccggggcgggggaccggga cccggggaccccccgcccagcgagacacacaagctggtggtcgtgggcggcggaggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctactttgtgtccgactacgacccc accattgaggactcctacacgaagatctgcacggtggatggcattcctgctcggctggat atcctggacacggctggccaggaggagtttggggccatgcgggagcagtacatgcgtgct ggccatggtttcctgcttgtgttcgccattaacgaccaccagagtttcaacgaggtgagc aagttgttcacacagatcctccgggttaaggaccgtgatgatttcccagtggtgctggtc ggaaacaaggcagatttggagtcacagcgccaggtcctcagatcggaagcactgaccttc agcgctaccaaccacgtggcctacttcgaggcctccgccaaactgcgactcaacgtggac gaggccttcgaacagctggtgcgggctgtccgaaaataccaggagcaagagctgccccca agtccccccagtgcccccaggaagaagaatggaggctgcccctgtgtcctgctctag

DBGET integrated database retrieval system