Dipodomys ordii (Ord's kangaroo rat): 105994567 Help Entry 105994567         CDS       T07834                                  Symbol Rhoa Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04014   Ras signaling pathway dord04015   Rap1 signaling pathway dord04022   cGMP-PKG signaling pathway dord04024   cAMP signaling pathway dord04062   Chemokine signaling pathway dord04071   Sphingolipid signaling pathway dord04072   Phospholipase D signaling pathway dord04081   Hormone signaling dord04144   Endocytosis dord04150   mTOR signaling pathway dord04270   Vascular smooth muscle contraction dord04310   Wnt signaling pathway dord04350   TGF-beta signaling pathway dord04360   Axon guidance dord04510   Focal adhesion dord04520   Adherens junction dord04530   Tight junction dord04611   Platelet activation dord04621   NOD-like receptor signaling pathway dord04625   C-type lectin receptor signaling pathway dord04660   T cell receptor signaling pathway dord04670   Leukocyte transendothelial migration dord04722   Neurotrophin signaling pathway dord04810   Regulation of actin cytoskeleton dord04921   Oxytocin signaling pathway dord04928   Parathyroid hormone synthesis, secretion and action dord04972   Pancreatic secretion dord05100   Bacterial invasion of epithelial cells dord05132   Salmonella infection dord05133   Pertussis dord05135   Yersinia infection dord05152   Tuberculosis dord05163   Human cytomegalovirus infection dord05200   Pathways in cancer dord05203   Viral carcinogenesis dord05205   Proteoglycans in cancer dord05206   MicroRNAs in cancer dord05210   Colorectal cancer dord05417   Lipid and atherosclerosis dord05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105994567 (Rhoa)    04015 Rap1 signaling pathway     105994567 (Rhoa)    04310 Wnt signaling pathway     105994567 (Rhoa)    04350 TGF-beta signaling pathway     105994567 (Rhoa)    04072 Phospholipase D signaling pathway     105994567 (Rhoa)    04071 Sphingolipid signaling pathway     105994567 (Rhoa)    04024 cAMP signaling pathway     105994567 (Rhoa)    04022 cGMP-PKG signaling pathway     105994567 (Rhoa)    04150 mTOR signaling pathway     105994567 (Rhoa)   09133 Signaling molecules and interaction    04081 Hormone signaling     105994567 (Rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105994567 (Rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105994567 (Rhoa)    04520 Adherens junction     105994567 (Rhoa)    04530 Tight junction     105994567 (Rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105994567 (Rhoa)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     105994567 (Rhoa)    04621 NOD-like receptor signaling pathway     105994567 (Rhoa)    04625 C-type lectin receptor signaling pathway     105994567 (Rhoa)    04660 T cell receptor signaling pathway     105994567 (Rhoa)    04670 Leukocyte transendothelial migration     105994567 (Rhoa)    04062 Chemokine signaling pathway     105994567 (Rhoa)   09152 Endocrine system    04921 Oxytocin signaling pathway     105994567 (Rhoa)    04928 Parathyroid hormone synthesis, secretion and action     105994567 (Rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     105994567 (Rhoa)   09154 Digestive system    04972 Pancreatic secretion     105994567 (Rhoa)   09156 Nervous system    04722 Neurotrophin signaling pathway     105994567 (Rhoa)   09158 Development and regeneration    04360 Axon guidance     105994567 (Rhoa)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105994567 (Rhoa)    05206 MicroRNAs in cancer     105994567 (Rhoa)    05205 Proteoglycans in cancer     105994567 (Rhoa)    05203 Viral carcinogenesis     105994567 (Rhoa)   09162 Cancer: specific types    05210 Colorectal cancer     105994567 (Rhoa)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     105994567 (Rhoa)   09171 Infectious disease: bacterial    05132 Salmonella infection     105994567 (Rhoa)    05135 Yersinia infection     105994567 (Rhoa)    05133 Pertussis     105994567 (Rhoa)    05152 Tuberculosis     105994567 (Rhoa)    05100 Bacterial invasion of epithelial cells     105994567 (Rhoa)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105994567 (Rhoa)    05418 Fluid shear stress and atherosclerosis     105994567 (Rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dord04131]     105994567 (Rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dord04147]     105994567 (Rhoa)    04031 GTP-binding proteins [BR:dord04031]     105994567 (Rhoa) Membrane trafficking [BR:dord04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     105994567 (Rhoa) Exosome [BR:dord04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105994567 (Rhoa)   Exosomal proteins of other body fluids (saliva and urine)    105994567 (Rhoa)   Exosomal proteins of colorectal cancer cells    105994567 (Rhoa)   Exosomal proteins of bladder cancer cells    105994567 (Rhoa) GTP-binding proteins [BR:dord04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     105994567 (Rhoa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  105994567 NCBI-ProteinID:  XP_012883581 Ensembl:  ENSDORG00000025671 UniProt:  A0A1S3G6D5 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccgaaagaaacttgtgattgtcggtgatggagcttgtggcaagacatgc ttgctcatagtcttcagcaaggaccagttcccagaggtttatgtgcccactgtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagaattggctttgtgggacaca gctgggcaggaagattatgatcgcctgagacccctctcctacccagacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccagaagttaagcatttctgtcccaacgtgcccattatcctggttggaaacaagaaggat cttcggaatgatgagcacacaaggcgggagttagctaagatgaagcaggagccagttaaa cctgaagagggcagagatatggccaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagacggagtgagagaggtttttgaaatggccacaagagccgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system