Dipodomys ordii (Ord's kangaroo rat): 105994673 Help Entry 105994673         CDS       T07834                                  Symbol Rab8a Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04140   Autophagy - animal dord04144   Endocytosis dord04152   AMPK signaling pathway dord04530   Tight junction dord04972   Pancreatic secretion dord05014   Amyotrophic lateral sclerosis dord05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     105994673 (Rab8a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105994673 (Rab8a)    04140 Autophagy - animal     105994673 (Rab8a)   09144 Cellular community - eukaryotes    04530 Tight junction     105994673 (Rab8a)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     105994673 (Rab8a)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105994673 (Rab8a)    05022 Pathways of neurodegeneration - multiple diseases     105994673 (Rab8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dord04131]     105994673 (Rab8a)    03036 Chromosome and associated proteins [BR:dord03036]     105994673 (Rab8a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dord04147]     105994673 (Rab8a)    04031 GTP-binding proteins [BR:dord04031]     105994673 (Rab8a) Membrane trafficking [BR:dord04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     105994673 (Rab8a)  Autophagy   Other autophagy associated proteins     105994673 (Rab8a) Chromosome and associated proteins [BR:dord03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     105994673 (Rab8a) Exosome [BR:dord04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105994673 (Rab8a)   Exosomal proteins of other body fluids (saliva and urine)    105994673 (Rab8a)   Exosomal proteins of colorectal cancer cells    105994673 (Rab8a) GTP-binding proteins [BR:dord04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     105994673 (Rab8a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  105994673 NCBI-ProteinID:  XP_012883755 Ensembl:  ENSDORG00000028823 UniProt:  A0A1S3G506 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNERSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLVSG GQGGAWRRRVRTARPLT NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccaccttcatctccacc ataggaattgactttaaaattaggacgatagagctggatggcaagagaatcaagcttcag atctgggacacagcgggccaggagcgcttccggaccatcaccaccgcctactaccggggc gccatgggcatcatgctggtctacgacatcaccaacgagcgctccttcgacaacatccgc aactggatccgcaacatcgaggagcacgcatcggcggacgtggagaagatgatcctgggg aacaagtgcgacgtgaacgacaagaggcaggtgtccaaggagcggggcgagaagctggcg ctggactacggcatcaagttcatggagaccagcgccaaggccaacatcaacgtggagaac gcgtttttcacgctcgccagggacatcaaagccaaaatggacaagaagctggtgagtggg gggcagggcggagcctggcggcggcgcgtgcgcactgcgcgacccctgacc

DBGET integrated database retrieval system