Dipodomys ordii (Ord's kangaroo rat): 105994960 Help Entry 105994960         CDS       T07834                                  Symbol Pttg1 Name (RefSeq) securin   KO K06635   securin Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04110   Cell cycle dord04114   Oocyte meiosis dord05166   Human T-cell leukemia virus 1 infection Brite KEGG Orthology (KO) [BR:dord00001]  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     105994960 (Pttg1)    04114 Oocyte meiosis     105994960 (Pttg1)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105994960 (Pttg1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dord03036]     105994960 (Pttg1) Chromosome and associated proteins [BR:dord03036]  Eukaryotic type   Sister chromatid separation proteins    Securin and associated proteins     105994960 (Pttg1) SSDB OrthologParalogGFIT Motif Pfam:  Securin Motif Other DBs NCBI-GeneID:  105994960 NCBI-ProteinID:  XP_012884083 UniProt:  A0A1S3G5I6 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search MATLIFVDKENGQPGTRMAPKEGLKLGSGPVKALDGRTQVSTPRVGKVFNAPSALPKTAR KALGTVNRATEKPGKTNGPLKQKQLSFTGKKVSSLEQPCVPFADWVKERRAFVDVSCETL FSAHG NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcgactctgatctttgttgacaaggagaatggacagccaggcacccgtatggctcct aaggaggggctgaagctggggtccgggcctgtcaaagccttagatgggagaacgcaggtt tcaacaccacgcgttgggaaggtcttcaatgctccatcggccttacctaaaactgcccgg aaggccttgggaacggttaaccgggctacagagaagccagggaagactaacggacccctc aaacaaaagcagctgagcttcactggcaaaaaggtgagttccctggagcagccctgcgtg ccgttcgctgattgggtgaaggagaggcgggcctttgtggatgtcagctgtgagaccctc ttcagtgctcatggatag

DBGET integrated database retrieval system