Dipodomys ordii (Ord's kangaroo rat): 105995767 Help Entry 105995767         CDS       T07834                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism dord  Dipodomys ordii (Ord's kangaroo rat) Brite KEGG Orthology (KO) [BR:dord00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:dord03041]     105995767   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     105995767 Spliceosome [BR:dord03041]  Complex B   Other components    Complex B specific factors     105995767 Cytokines and neuropeptides [BR:dord04052]  Neuropeptides   Unclassified    105995767 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  105995767 NCBI-ProteinID:  XP_012885063 Ensembl:  ENSDORG00000028555 UniProt:  A0A1S3GN81 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctggggaagaaagtccgcgtgaagtgcaacacc gatgacaccatcggggaccttaagaagttaatcgctgcccaaactggcacccgttggaac aaaattgtccttaaaaaatggtacacgattttcaaggaccatgtgtctctgggggattat gaaatccatgatggaatgaacctggaactttactaccagtag

DBGET integrated database retrieval system