Dipodomys ordii (Ord's kangaroo rat): 105996997 Help Entry 105996997         CDS       T07834                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04613   Neutrophil extracellular trap formation dord05034   Alcoholism dord05203   Viral carcinogenesis dord05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dord00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105996997  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105996997   09163 Immune disease    05322 Systemic lupus erythematosus     105996997   09165 Substance dependence    05034 Alcoholism     105996997  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dord03036]     105996997   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dord04147]     105996997 Chromosome and associated proteins [BR:dord03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105996997 Exosome [BR:dord04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105996997 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  105996997 NCBI-ProteinID:  XP_012886718 UniProt:  A0A1S3GFF9 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagcgaagtccgctcccgcgcccaagaaggggtcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgtagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcttctcgc ctggcgcactacaacaagcgctcgaccatcacgtctcgggagatccagacggccgtgcgc ctgctgctgcctggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system