Dipodomys ordii (Ord's kangaroo rat): 105997008 Help Entry 105997008         CDS       T07834                                  Name (RefSeq) histone H2B type 1-like   KO K11252   histone H2B Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04613   Neutrophil extracellular trap formation dord05034   Alcoholism dord05203   Viral carcinogenesis dord05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dord00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105997008  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105997008   09163 Immune disease    05322 Systemic lupus erythematosus     105997008   09165 Substance dependence    05034 Alcoholism     105997008  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dord03036]     105997008   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dord04147]     105997008 Chromosome and associated proteins [BR:dord03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105997008 Exosome [BR:dord04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105997008 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  105997008 NCBI-ProteinID:  XP_012886729 Ensembl:  ENSDORG00000025972 UniProt:  A0A1S3GEQ3 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPARSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagctagatctgccccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcactacaacaagcgctcgaccatcacgtctcgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system