Dipodomys ordii (Ord's kangaroo rat): 105997073 Help Entry 105997073         CDS       T07834                                  Symbol Csnk2b Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord03008   Ribosome biogenesis in eukaryotes dord03083   Polycomb repressive complex dord04064   NF-kappa B signaling pathway dord04137   Mitophagy - animal dord04310   Wnt signaling pathway dord04520   Adherens junction dord05010   Alzheimer disease dord05020   Prion disease dord05022   Pathways of neurodegeneration - multiple diseases dord05162   Measles dord05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:dord00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     105997073 (Csnk2b)   09126 Chromosome    03083 Polycomb repressive complex     105997073 (Csnk2b)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105997073 (Csnk2b)    04064 NF-kappa B signaling pathway     105997073 (Csnk2b)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     105997073 (Csnk2b)   09144 Cellular community - eukaryotes    04520 Adherens junction     105997073 (Csnk2b)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105997073 (Csnk2b)   09172 Infectious disease: viral    05162 Measles     105997073 (Csnk2b)   09164 Neurodegenerative disease    05010 Alzheimer disease     105997073 (Csnk2b)    05020 Prion disease     105997073 (Csnk2b)    05022 Pathways of neurodegeneration - multiple diseases     105997073 (Csnk2b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:dord03009]     105997073 (Csnk2b)    03036 Chromosome and associated proteins [BR:dord03036]     105997073 (Csnk2b) Ribosome biogenesis [BR:dord03009]  Eukaryotic type   90S particles    Kinase     105997073 (Csnk2b) Chromosome and associated proteins [BR:dord03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      105997073 (Csnk2b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  105997073 NCBI-ProteinID:  XP_012886822 Ensembl:  ENSDORG00000014179 UniProt:  A0A1S3GFQ8 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagtagctcagaggaggtatcctggatttcctggttctgtgggctccgtggcaatgag ttcttctgtgaagtggatgaagactacatccaggacaaatttaatcttaccggactcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagtgacctgattgagcaggcagctgagatgctttat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccaaatgttggaaaag taccagcagggagactttggctactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcagacatcccaggcgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcaaggcaccatcacacggacggcgcctacttcggc accggtttccctcacatgctcttcatggtgcatcccgagtaccggcccaagcgacctgcc aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcttaccagctgcaa ctccaagctgccagcaacttcaagagcccagtcaagaccattcgctga

DBGET integrated database retrieval system