Dipodomys ordii (Ord's kangaroo rat): 105997570 Help Entry 105997570         CDS       T07834                                  Symbol Ubb Name (RefSeq) polyubiquitin-B   KO K04551   ubiquitin B Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04120   Ubiquitin mediated proteolysis dord04137   Mitophagy - animal dord04140   Autophagy - animal dord05012   Parkinson disease dord05022   Pathways of neurodegeneration - multiple diseases dord05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:dord00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105997570 (Ubb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105997570 (Ubb)    04137 Mitophagy - animal     105997570 (Ubb)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     105997570 (Ubb)   09164 Neurodegenerative disease    05012 Parkinson disease     105997570 (Ubb)    05022 Pathways of neurodegeneration - multiple diseases     105997570 (Ubb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dord04121]     105997570 (Ubb)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dord04147]     105997570 (Ubb) Ubiquitin system [BR:dord04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    105997570 (Ubb) Exosome [BR:dord04147]  Exosomal proteins   Exosomal proteins of breast milk    105997570 (Ubb)   Exosomal proteins of other body fluids (saliva and urine)    105997570 (Ubb)   Exosomal proteins of colorectal cancer cells    105997570 (Ubb)   Exosomal proteins of bladder cancer cells    105997570 (Ubb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N UBL_UBAC1 HATPase_c Motif Other DBs NCBI-GeneID:  105997570 NCBI-ProteinID:  XP_012887500 Ensembl:  ENSDORG00000027430 UniProt:  A0A1S3GFL3 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccttgactggcaagaccatcactctagaggttgagcccagt gataccattgagaatgtgaaggccaagatccaggataaagagggcatccctcctgaccag cagaggctgatcttcgcaggcaagcagctggaagatggccgcactctttctgactacaac atccagaaggagtccaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttc gtgaagaccctgaccggcaagaccattaccctggaggtggagcccagtgataccattgag aatgtgaaggccaagatccaggataaagagggcatccctcccgaccagcagaggctgatc ttcgcaggcaagcagctggaagatggccgcactctttctgactacaacatccagaaagag tccaccctgcacctggttctccgtctcaggggtggctattag

DBGET integrated database retrieval system