KEGG   Dipodomys ordii (Ord's kangaroo rat): 105997849
Entry
105997849         CDS       T07834                                 
Symbol
Timm17b
Name
(RefSeq) mitochondrial import inner membrane translocase subunit Tim17-B
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
dord  Dipodomys ordii (Ord's kangaroo rat)
Brite
KEGG Orthology (KO) [BR:dord00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dord03029]
    105997849 (Timm17b)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dord02000]
    105997849 (Timm17b)
Mitochondrial biogenesis [BR:dord03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    105997849 (Timm17b)
Transporters [BR:dord02000]
 Other transporters
  Primary active transporters [TC:3]
   105997849 (Timm17b)
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 105997849
NCBI-ProteinID: XP_012887848
UniProt: A0A1S3GG59
LinkDB
Position
Unknown
AA seq 173 aa
MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAVKGFRNAPVGLRHKLRNSVQALRLQAP
QIQGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGG
ILLALIEGVGILLTRYTAQQFRNAPPFFEDPSQLGPKDGSSPAPGYPGYQQFH
NT seq 522 nt   +upstreamnt  +downstreamnt
atggaggagtacgctcgggagccttgcccatggaggattgtggatgactgcggaggagcc
ttcactatgggtgtcattggtggtggagtcttccaggcagtcaagggctttcgtaatgcc
cctgttggcctcaggcataagctcaggaacagtgtccaggccctgagattacaggcgccc
caaattcaaggtagttttgcagtgtggggaggcctattctccaccattgattgtggcttg
gtacgacttcgaggcaaagaggatccctggaactccatcaccagtggtgccttgactggg
gctgtgctggctgctcgcagtggcccattggccatggtgggctcagccatgatggggggc
atcctattggccctcattgagggtgtgggcatcctcctcacacgctataccgcacagcag
ttccgcaatgcacctccattcttcgaagaccccagtcaactaggtccaaaggatggtagt
agcccagctcctggctatcctggctaccaacaattccactga

DBGET integrated database retrieval system