Dipodomys ordii (Ord's kangaroo rat): 105998443 Help Entry 105998443         CDS       T07834                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:dord00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     105998443  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dord03036]     105998443    03400 DNA repair and recombination proteins [BR:dord03400]     105998443 Chromosome and associated proteins [BR:dord03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      105998443 DNA repair and recombination proteins [BR:dord03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      105998443 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa Bromo_TP Motif Other DBs NCBI-GeneID:  105998443 NCBI-ProteinID:  XP_012888607 Ensembl:  ENSDORG00000028751 UniProt:  A0A1S3GKS9 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MEEGEEAEEQQRFSYQQRLKAAVHYTVGCLCKEVELDKEMPFSKQTIAAISELTFRQCDN FAKDLEMFARHAKRSTINTDDVKLLARRSNSLLKYITEKNEEIAQFNLERKTKKKKKLED GNKNPREHADEEMVE NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggaggagggggaggaagccgaggagcaacagcgattctcctaccagcagaggctaaag gctgcagttcactatacagttggttgtctttgcaaagaagttgagttggacaaagagatg ccattcagcaaacagaccatcgcagcaatttcggagctgacttttcggcagtgcgataat tttgccaaagaccttgagatgtttgcaagacacgcgaaaagaagcacaattaacaccgac gatgtgaagctcttagcgaggaggagtaattcactgctaaaatacatcacagagaagaat gaggagattgctcagtttaatctagaacgaaaaacaaagaagaaaaagaaattggaggat ggaaacaaaaaccccagggagcacgcagacgaagagatggtagagtga

DBGET integrated database retrieval system